PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10004150
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family M-type_MADS
Protein Properties Length: 305aa    MW: 33523.8 Da    PI: 5.8083
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10004150genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF31.32.7e-101050242
                 ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-T CS
       SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifss 42
                 ri ++s r+ + ++R++gi+KK  EL +LC++ +  ii s+
  Lus10004150 10 RIVDESARKQSMTRRQKGIMKKVDELTTLCGVPAVCIINSP 50
                 6889999*************************988888775 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006614.045149IPR002100Transcription factor, MADS-box
SMARTSM004329.8E-8160IPR002100Transcription factor, MADS-box
CDDcd002664.14E-15292No hitNo description
SuperFamilySSF554555.62E-163101IPR002100Transcription factor, MADS-box
PfamPF003193.7E-101050IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 305 aa     Download sequence    Send to blast
MGGKKVELVR IVDESARKQS MTRRQKGIMK KVDELTTLCG VPAVCIINSP AVPGAAPKPP  60
LVWPSNDDEQ VRQLIQRYYS ISEAEREKKK TDQETYLEEM IAKTELKHSK LKKKNENREA  120
ELLMDEVHFG KGLNGMDMNE LDTIKRLLTQ RLNVFSTKRG GQPQQPPTQA PEDGPQCSPN  180
LPIRFGVGNQ PVEMGVADMD VDPTGPINTH NVFPDPQRFS SAYEMGQGSG SGGIVDNGDL  240
SIMFVNAREV ANSHGNNFST PSAPAAERTS ELAQVPTTRV DGEGDDLNLN CLRSVESRQQ  300
KPQL*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G05860.21e-17M-type_MADS family protein